Structure of PDB 5v1u Chain C Binding Site BS01

Receptor Information
>5v1u Chain C (length=85) Species: 525904 (Thermobaculum terrenum ATCC BAA-798) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKISDAVVSAHIDDEVVLLHLQTGTYFGLDAVGSRIWSLLEEGKRPEEIV
DAICAEYSVDRPTVERDLRDFLRALANKELLEGYA
Ligand information
>5v1u Chain G (length=16) Species: 525904 (Thermobaculum terrenum ATCC BAA-798) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KTYTAPTLVEYGGLER
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v1u Steric complementarity directs sequence promiscuous leader binding in RiPP biosynthesis.
Resolution2.052 Å
Binding residue
(original residue number in PDB)
G24 T25 Y26 F27 G28 L29 D30 V32 I36 Y57 D67 F71 K78
Binding residue
(residue number reindexed from 1)
G24 T25 Y26 F27 G28 L29 D30 V32 I36 Y57 D67 F71 K78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:5v1u, PDBe:5v1u, PDBj:5v1u
PDBsum5v1u
PubMed31719203
UniProtD1CIZ5

[Back to BioLiP]