Structure of PDB 5v1d Chain C Binding Site BS01

Receptor Information
>5v1d Chain C (length=244) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLVIISTLDGRIAALDPENHGKKQWDLDVGSGSLVSSSLSKMIIPSLDGD
LFQWDRDRESMETVPFTVESLLEDVVLVGGKSLTTYGLSAYSGKVRYICS
ALGCRQWDDILLLQRTQKTVRAVGPRSGNEKWNFSVGHFELRYIPSDVEE
QEAVMMDTVIKVSVADWKVMAFNKKGGHLEWEYQFSTPIASAWLVKDGKV
IPISLFDDTSIVEAARGATENSVYLGMYRGQLYLQSSVRISEKF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v1d The luminal domain of the ER stress sensor protein PERK binds misfolded proteins and thereby triggers PERK oligomerization
Resolution2.799 Å
Binding residue
(original residue number in PDB)
W165 M172 E173 E384 S386 V387 Y388 L389
Binding residue
(residue number reindexed from 1)
W54 M61 E62 E220 S222 V223 Y224 L225
Enzymatic activity
Enzyme Commision number ?
External links