Structure of PDB 5u1q Chain C Binding Site BS01

Receptor Information
>5u1q Chain C (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLC
HLQKVKHYLILPSEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLL
RHCCT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5u1q Discovery, Development, and Cellular Delivery of Potent and Selective Bicyclic Peptide Inhibitors of Grb7 Cancer Target.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R438 K478 H479 Y480 L481 M495
Binding residue
(residue number reindexed from 1)		R16 K56 H57 Y58 L59 M72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5u1q, PDBe:5u1q, PDBj:5u1q
PDBsum5u1q
PubMed29083893
UniProtQ14451|GRB7_HUMAN Growth factor receptor-bound protein 7 (Gene Name=GRB7)

[Back to BioLiP]