Structure of PDB 5tp1 Chain C Binding Site BS01

Receptor Information
>5tp1 Chain C (length=155) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LNVDPSLQIDIPDALSERDKVKFTVHTKTTLSTFQSPEFSVTRQHEDFVW
LHDTLTETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKM
KQELEAEYLAVFKKTVSTHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSV
RRKNT
Ligand information
>5tp1 Chain R (length=19) Species: 272561 (Chlamydia trachomatis D/UW-3/CX) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PTVQFFKGKNGSADKVILV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tp1 Chlamydia interfere with an interaction between the mannose-6-phosphate receptor and sorting nexins to counteract host restriction.
Resolution2.31 Å
Binding residue
(original residue number in PDB)
P36 D37 A38 L39 S40 E41 K125 E129 Y132 L133 F136 V140
Binding residue
(residue number reindexed from 1)
P12 D13 A14 L15 S16 E17 K101 E105 Y108 L109 F112 V116
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035091 phosphatidylinositol binding

View graph for
Molecular Function
External links
PDB RCSB:5tp1, PDBe:5tp1, PDBj:5tp1
PDBsum5tp1
PubMed28252385
UniProtQ9D8U8|SNX5_MOUSE Sorting nexin-5 (Gene Name=Snx5)

[Back to BioLiP]