Structure of PDB 5tgj Chain C Binding Site BS01

Receptor Information
>5tgj Chain C (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTL
IETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELE
AEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQ
Ligand information
>5tgj Chain B (length=22) Species: 813 (Chlamydia trachomatis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GPAVQFFKGKNGSADQVILVTQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tgj Structure of the SNX5 PX domain in complex with chlamydial protein IncE
Resolution2.6 Å
Binding residue
(original residue number in PDB)		D37 T48
Binding residue
(residue number reindexed from 1)		D8 T19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035091 phosphatidylinositol binding

View graph for
Molecular Function
External links
PDB RCSB:5tgj, PDBe:5tgj, PDBj:5tgj
PDBsum5tgj
PubMed
UniProtQ9Y5X3|SNX5_HUMAN Sorting nexin-5 (Gene Name=SNX5)

[Back to BioLiP]