Structure of PDB 5t0n Chain C Binding Site BS01

Receptor Information

>5t0n Chain C (length=360) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYI
AIMAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKL
LAHRPWLITKEHIQALLKEHTWSLAELIQALVLLTHCHSLSSFVFGCGIL
PEPPSEQSSPRDVEALMERMQQLQEEMESRFELEKSESLPDMLCFVEDPT
FGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAA
YSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERN
LKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLY
ALRAITRYMT

Ligand information

Ligand ID

LEU

InChI

InChI=1S/C6H13NO2/c1-4(2)3-5(7)6(8)9/h4-5H,3,7H2,1-2H3,(H,8,9)/t5-/m0/s1

InChIKey

ROHFNLRQFUQHCH-YFKPBYRVSA-N

SMILES

Software	SMILES
OpenEye OEToolkits 1.5.0	CC(C)C[C@@H](C(=O)O)N
CACTVS 3.341	CC(C)C[C@H](N)C(O)=O
OpenEye OEToolkits 1.5.0	CC(C)CC(C(=O)O)N
ACDLabs 10.04	O=C(O)C(N)CC(C)C
CACTVS 3.341	CC(C)C[CH](N)C(O)=O

Formula

C6 H13 N O2

Name

LEUCINE

PDB chain

5t0n Chain C Residue 501 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5t0n The apo-structure of the leucine sensor Sestrin2 is still elusive.
Resolution	3.004 Å
Binding residue (original residue number in PDB)	T374 Y375 T377 T386 E451
Binding residue (residue number reindexed from 1)	T254 Y255 T257 T266 E331
Annotation score	1

Enzymatic activity

Enzyme Commision number

1.11.1.-

Gene Ontology

	Molecular Function
GO:0004601	peroxidase activity
GO:0005092	GDP-dissociation inhibitor activity
GO:0005515	protein binding
GO:0016491	oxidoreductase activity
GO:0016684	oxidoreductase activity, acting on peroxide as acceptor
GO:0032542	sulfiredoxin activity
GO:0042731	PH domain binding
GO:0044877	protein-containing complex binding
GO:0070728	L-leucine binding
GO:0140311	protein sequestering activity

	Biological Process
GO:0001932	regulation of protein phosphorylation
GO:0006111	regulation of gluconeogenesis
GO:0006635	fatty acid beta-oxidation
GO:0007005	mitochondrion organization
GO:0009749	response to glucose
GO:0016239	positive regulation of macroautophagy
GO:0030308	negative regulation of cell growth
GO:0030330	DNA damage response, signal transduction by p53 class mediator
GO:0032042	mitochondrial DNA metabolic process
GO:0032868	response to insulin
GO:0034198	cellular response to amino acid starvation
GO:0034599	cellular response to oxidative stress
GO:0042149	cellular response to glucose starvation
GO:0042593	glucose homeostasis
GO:0046323	D-glucose import
GO:0051897	positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0070328	triglyceride homeostasis
GO:0071230	cellular response to amino acid stimulus
GO:0071233	cellular response to L-leucine
GO:0072593	reactive oxygen species metabolic process
GO:0098869	cellular oxidant detoxification
GO:1900182	positive regulation of protein localization to nucleus
GO:1901031	regulation of response to reactive oxygen species
GO:1902010	negative regulation of translation in response to endoplasmic reticulum stress
GO:1903432	regulation of TORC1 signaling
GO:1904262	negative regulation of TORC1 signaling
GO:1904263	positive regulation of TORC1 signaling
GO:1904504	positive regulation of lipophagy
GO:1990253	cellular response to leucine starvation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005765	lysosomal membrane
GO:0005829	cytosol
GO:0031588	nucleotide-activated protein kinase complex
GO:0031932	TORC2 complex
GO:1990316	Atg1/ULK1 kinase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5t0n, PDBe:5t0n, PDBj:5t0n
PDBsum	5t0n
PubMed	27649739
UniProt	P58004\|SESN2_HUMAN Sestrin-2 (Gene Name=SESN2)

[Back to BioLiP]