Structure of PDB 5sxp Chain C Binding Site BS01

Receptor Information
>5sxp Chain C (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWF
PSNYVREVKA
Ligand information
>5sxp Chain G (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GKPSRPPRPSRPPPPTPRRPA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5sxp Molecular basis of interactions between SH3 domain-containing proteins and the proline-rich region of the ubiquitin ligase Itch.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		F193 T198 D201 E202 R215 G219 W221 E223 T230 W232 N236 Y237
Binding residue
(residue number reindexed from 1)		F10 T15 D18 E19 R32 G36 W38 E40 T47 W49 N53 Y54
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5sxp, PDBe:5sxp, PDBj:5sxp
PDBsum5sxp
PubMed28235806
UniProtQ14155|ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 (Gene Name=ARHGEF7)

[Back to BioLiP]