Structure of PDB 5oxw Chain C Binding Site BS01

Receptor Information
>5oxw Chain C (length=80) Species: 228908 (Nanoarchaeum equitans Kin4-M) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIEVIENGIKKKEKLSDLFNKYYAGFQIGEKHYAFPPDLYVYDGERWVKV
YSIIKHETETDLYEINGITLSANHLVLSKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5oxw Structural Insights into Subunits Assembly and the Oxyester Splicing Mechanism of Neq pol Split Intein.
Resolution2.61 Å
Binding residue
(original residue number in PDB)		D48 R51 Y68 E69 I70 N71 G72 I73 T74
Binding residue
(residue number reindexed from 1)		D43 R46 Y63 E64 I65 N66 G67 I68 T69
Enzymatic activity
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
External links