Structure of PDB 5ovt Chain C Binding Site BS01

Receptor Information

>5ovt Chain C (length=183) Species: 36861 (Thiobacillus denitrificans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TTVTIVRKDGRIAIAADTLTKWGGGKESADYVANHEKIIRVGDSYVAITG
SATFKLILADYFASLDEPPQLDSVARIFCVWNTLHGALKEHYYLQDLESS
RLDVLIANPRGIFGVAAHRTVQEFSKFYAYGSGSPYALGALYAAYRAPSL
DAEAVARLGVLAAAEFHDESGLPVQSFVLELSP

Ligand information

>5ovt Chain c (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

IITg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5ovt Structural characterization of the bacterial proteasome homolog BPH reveals a tetradecameric double-ring complex with unique inner cavity properties.
Resolution	2.95 Å
Binding residue (original residue number in PDB)	T1 T20 K21 W22 G50 A52 E176
Binding residue (residue number reindexed from 1)	T1 T20 K21 W22 G50 A52 E169

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:5ovt, PDBe:5ovt, PDBj:5ovt
PDBsum	5ovt
PubMed	29183996
UniProt	A0A2R2JFN0

[Back to BioLiP]