Structure of PDB 5otw Chain C Binding Site BS01

Receptor Information
>5otw Chain C (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPG
SFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEE
Ligand information
>5otw Chain D (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GCFTSDVSSYLEGQAAKEFIAWLVKG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5otw alpha-Helix or beta-Turn? An Investigation into N-Terminally Constrained Analogues of Glucagon-like Peptide 1 (GLP-1) and Exendin-4.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		L32 T35 W39 E68 Y69 Y88 L89 P90 W91 R121 E128
Binding residue
(residue number reindexed from 1)		L4 T7 W11 E40 Y41 Y60 L61 P62 W63 R93 E100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004967 glucagon receptor activity
GO:0008528 G protein-coupled peptide receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5otw, PDBe:5otw, PDBj:5otw
PDBsum5otw
PubMed29877701
UniProtP43220|GLP1R_HUMAN Glucagon-like peptide 1 receptor (Gene Name=GLP1R)

[Back to BioLiP]