Structure of PDB 5nhk Chain C Binding Site BS01

Receptor Information

>5nhk Chain C (length=130) Species: 263 (Francisella tularensis)

KEFGFKVTQPRVEILKLFEKNKDKHLSPDDVFSKLKAQGSTTGIATVYRV
LNQFESAGIINRLKLDNEQVMYELNQGEHHDHIICVKCNMIQEFYSPGIE
ALQKQIVESFGAEMIDYSLNIYVKCKSCRE

Ligand information

• Ligand ID: FE
• InChI: InChI=1S/Fe/q+3
• InChIKey: VTLYFUHAOXGGBS-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Fe+3]
• Formula: Fe
• Name: FE (III) ION
• DrugBank: DB13949
• PDB chain: 5nhk Chain C Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5nhk Structural and functional studies of the metalloregulator Fur identify a promoter-binding mechanism and its role inFrancisella tularensisvirulence.
• Resolution: 1.8 Å
• Binding residue (original residue number in PDB): H33 E81 H88 H90 E101
• Binding residue (residue number reindexed from 1): H25 E73 H80 H82 E93
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:1900705 negative regulation of siderophore biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:5nhk, PDBe:5nhk, PDBj:5nhk
• PDBsum: 5nhk
• PubMed: 30271974
• UniProt: Q5NIN6