Structure of PDB 5mu0 Chain C Binding Site BS01

Receptor Information

>5mu0 Chain C (length=212) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVKLEESGGGLVQPGGSMKLSCAASGFTFSDAWMDWVRQSPEKGLEWVAE
IRNKVNNHATNYAESVKGRFTISRDDSRSVVYLQMNNLKPEDTGIYYCTG
LTFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGGSSVTLGCLVKGYFPEPV
TLTWNSGSLSSGVHTFPALLLSGLYTLSSSVTVTSNTWPSQTITCNVAHP
ASSTKVDKKIEP

Ligand information

>5mu0 Chain R (length=10) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GARGLTGRPG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5mu0 Anti-citrullinated protein antibodies cause arthritis by cross-reactivity to joint cartilage.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	D31 A32 W33 R52 L101 T102 F103 D104
Binding residue (residue number reindexed from 1)	D31 A32 W33 R52 L101 T102 F103 D104

External links

PDB	RCSB:5mu0, PDBe:5mu0, PDBj:5mu0
PDBsum	5mu0
PubMed	28679953

[Back to BioLiP]