Structure of PDB 5ms4 Chain C Binding Site BS01

Receptor Information

>5ms4 Chain C (length=228) Species: 9606 (Homo sapiens)

VLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVR
LGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASL
GSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQK
KCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDP
CGRSDKPGVYTNICRYLDWIKKIIGSKG

Ligand information

>5ms4 Chain G (length=3) Species: 32630 (synthetic construct)

LLR

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5ms4 Structural determinants of specificity and regulation of activity in the allosteric loop network of human KLK8/neuropsin.
• Resolution: 2.1 Å
• Binding residue (original residue number in PDB): H57 H99 D189 T190 S195 S214 W215 G216 S217 D218 C220
• Binding residue (residue number reindexed from 1): H41 H85 D174 T175 S180 S195 W196 G197 S198 D199 C201

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D102 Q192 G193 D194 S195
• Catalytic site (residue number reindexed from 1): H41 D88 Q177 G178 D179 S180
• Enzyme Commision number: 3.4.21.118: kallikrein 8.

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005515 protein binding
• GO:0008233 peptidase activity
• GO:0008236 serine-type peptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0007613 memory
• GO:0009611 response to wounding
• GO:0043616 keratinocyte proliferation
• GO:0048812 neuron projection morphogenesis
• GO:0050807 regulation of synapse organization
• GO:0050808 synapse organization

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0030141 secretory granule
• GO:0097180 serine protease inhibitor complex

External links

• PDB: RCSB:5ms4, PDBe:5ms4, PDBj:5ms4
• PDBsum: 5ms4
• PubMed: 30013126
• UniProt: O60259|KLK8_HUMAN Kallikrein-8 (Gene Name=KLK8)