Structure of PDB 5m0i Chain C Binding Site BS01

Receptor Information
>5m0i Chain C (length=240) Species: 285006 (Saccharomyces cerevisiae RM11-1a) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGSDIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFER
TTLIKFVKKLRFYNDSVLSYNASEFINEGKDPEADSFDKVILPIASMFVK
SVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFS
QWMIESLRIGSNLLDLEVVQFAIKSADEDGTNIGETDNIFLQEILPVNSE
EEFQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGKLK
Ligand information
>5m0i Chain E (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gauaacugaaucgaaagacauuaucacg
<<<<......<<....>>...>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5m0i Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
Resolution2.41 Å
Binding residue
(original residue number in PDB)		F176 S180 E183 D184
Binding residue
(residue number reindexed from 1)		F171 S175 E178 D179
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:1990825 sequence-specific mRNA binding
Biological Process
GO:0007533 mating type switching
GO:0008298 intracellular mRNA localization
GO:0051028 mRNA transport
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005934 cellular bud tip

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5m0i, PDBe:5m0i, PDBj:5m0i
PDBsum5m0i
PubMed28092367
UniProtP36068|SHE2_YEAST SWI5-dependent HO expression protein 2 (Gene Name=SHE2)

[Back to BioLiP]