Structure of PDB 5lum Chain C Binding Site BS01

Receptor Information
>5lum Chain C (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRY
RLPPGVDPAAVTSALSPEGVLSIQAAPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lum Structural Basis for the Interaction of a Human Small Heat Shock Protein with the 14-3-3 Universal Signaling Regulator.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
V90 K91 V92 S134 A135 L136
Binding residue
(residue number reindexed from 1)
V19 K20 V21 S63 A64 L65
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5lum, PDBe:5lum, PDBj:5lum
PDBsum5lum
PubMed28089448
UniProtO14558|HSPB6_HUMAN Heat shock protein beta-6 (Gene Name=HSPB6)

[Back to BioLiP]