Structure of PDB 5lsj Chain C Binding Site BS01

Receptor Information
>5lsj Chain C (length=199) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGIP
DCDISPVQIRKCTEKFLCFMKGHFDNLFSKMEQLFLQLILRIPSNILLPE
DKCKETPYSEEDFQHLQKEIEQLQEKYKTELCTKQALLAELEEQKIVQAK
LKQTLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lsj Structure of the MIS12 Complex and Molecular Basis of Its Interaction with CENP-C at Human Kinetochores.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		Q18 T19 L22 Q29 F33 K72
Binding residue
(residue number reindexed from 1)		Q17 T18 L21 Q28 F32 K71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000070 mitotic sister chromatid segregation
GO:0000278 mitotic cell cycle
GO:0007059 chromosome segregation
GO:0008608 attachment of spindle microtubules to kinetochore
GO:0051301 cell division
GO:0051315 attachment of mitotic spindle microtubules to kinetochore
GO:0051382 kinetochore assembly
Cellular Component
GO:0000444 MIS12/MIND type complex
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000922 spindle pole
GO:0000940 outer kinetochore
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lsj, PDBe:5lsj, PDBj:5lsj
PDBsum5lsj
PubMed27881301
UniProtQ9H081|MIS12_HUMAN Protein MIS12 homolog (Gene Name=MIS12)

[Back to BioLiP]