Structure of PDB 5l0y Chain C Binding Site BS01

Receptor Information
>5l0y Chain C (length=150) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNPKRSANINKLRESGNAEYRKQRYGDAIKLYTLGLQMALTRPAWEPAGL
VRDEIHQLYSNRAQAYMQLGQWPEAAADAECSVEAKRQGNAKAWYRRGKC
LMEMRRLQEAREWVARGLEFEGEEKELAELLKEIDSKLAAEKASRDAHDN
Ligand information
>5l0y Chain I (length=6) Species: 209285 (Thermochaetoides thermophila) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TVEEVD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l0y Two alternative binding mechanisms connect the protein translocation Sec71-Sec72 complex with heat shock proteins.
Resolution2.87 Å
Binding residue
(original residue number in PDB)		R80 N84 Q124 N128 Q131 K159 Y162 R163 E193
Binding residue
(residue number reindexed from 1)		R13 N17 Q57 N61 Q64 K92 Y95 R96 E126
Enzymatic activity
Enzyme Commision number ?
External links