Structure of PDB 5ksa Chain C Binding Site BS01

Receptor Information
>5ksa Chain C (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTL
YSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQFMDSNYQLI
WGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKD
SDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ksa Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R37 M109 N112
Binding residue
(residue number reindexed from 1)		R31 M93 N96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002250 adaptive immune response
GO:0009617 response to bacterium
Cellular Component
GO:0005886 plasma membrane
GO:0042101 T cell receptor complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ksa, PDBe:5ksa, PDBj:5ksa
PDBsum5ksa
PubMed27568928
UniProtA0A0B4J274;
P01848|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC)

[Back to BioLiP]