Structure of PDB 5k5o Chain C Binding Site BS01

Receptor Information
>5k5o Chain C (length=88) Species: 84600 (Sulfolobus sp. NOB8H2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAE
GYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5k5o Structures of archaeal DNA segregation machinery reveal bacterial and eukaryotic linkages.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Y9 P40 Q42 T43 Q46 N47
Binding residue
(residue number reindexed from 1)		Y5 P36 Q38 T39 Q42 N43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5k5o, PDBe:5k5o, PDBj:5k5o
PDBsum5k5o
PubMed26339031
UniProtO93706

[Back to BioLiP]