Structure of PDB 5jrc Chain C Binding Site BS01

Receptor Information
>5jrc Chain C (length=186) Species: 228908 (Nanoarchaeum equitans Kin4-M) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSAD
KYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIP
SKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLY
LDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jrc Structural basis for single-stranded RNA recognition and cleavage by C3PO
Resolution1.9 Å
Binding residue
(original residue number in PDB)		V23 S26 I27 S30 K34 I78 E82 E85 D117 L123 R124 Y168 I172 F179
Binding residue
(residue number reindexed from 1)		V24 S27 I28 S31 K35 I79 E83 E86 D118 L124 R125 Y169 I173 F180
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5jrc, PDBe:5jrc, PDBj:5jrc
PDBsum5jrc
PubMed27596600
UniProtQ74ML9

[Back to BioLiP]