Structure of PDB 5j37 Chain C Binding Site BS01

Receptor Information

>5j37 Chain C (length=206) Species: 77856 (Beak and feather disease virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FSTNRIYTLRLTRQFQFKINKQTTSVGNLIFNADYITFALDDFLQAVPNP
HTLNFEDYRIKLAKMEMRPTGGHYTVQSDGFGHTAVIQDSRITRFKTTAD
QTQDPLAPFDGAKKWFVSRGFKRLLRPKPQITIEDLTTANQSAALWLNSA
RTGWIPLQGGPNSAGTKVRHYGIAFSFPQPEQTITYVTKLTLYVQFRQFA
PNNPST

Ligand information

>5j37 Chain I (length=3) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5j37 Structural insights into the assembly and regulation of distinct viral capsid complexes.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	K154 K155
Binding residue (residue number reindexed from 1)	K113 K114

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0019062	virion attachment to host cell
GO:0019069	viral capsid assembly
GO:0046718	symbiont entry into host cell

	Cellular Component
GO:0039615	T=1 icosahedral viral capsid

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5j37, PDBe:5j37, PDBj:5j37
PDBsum	5j37
PubMed	27698405
UniProt	A0A023R6W2

[Back to BioLiP]