Structure of PDB 5izu Chain C Binding Site BS01

Receptor Information
>5izu Chain C (length=124) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTKRLFRHYTVGSYDSLTSHSDYVIDDKVAILQKRDHEGFGFVLRGAKAE
TPIEEFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEVNGVNVVKVG
HKQVVGLIRQGGNRLVMKVVSVTR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5izu A binding site outside the canonical PDZ domain determines the specific interaction between Shank and SAPAP and their function
Resolution2.494 Å
Binding residue
(original residue number in PDB)
T543 K544 R545 L546 F547 R548 H549 Y550 T551 L558
Binding residue
(residue number reindexed from 1)
T2 K3 R4 L5 F6 R7 H8 Y9 T10 L17
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5izu, PDBe:5izu, PDBj:5izu
PDBsum5izu
PubMed27185935
UniProtQ4ACU6|SHAN3_MOUSE SH3 and multiple ankyrin repeat domains protein 3 (Gene Name=Shank3)

[Back to BioLiP]