Structure of PDB 5hlh Chain C Binding Site BS01

Receptor Information
>5hlh Chain C (length=133) Species: 1282 (Staphylococcus epidermidis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQMRLANQLCFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLWEENPQ
TLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQ
QQQEAVFEAISSCLYDETKYVFEELEQTLKHLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hlh Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y17 R21 L55 N56 S66 N67 T70 R86 R92 L94
Binding residue
(residue number reindexed from 1)		Y14 R18 L52 N53 S63 N64 T67 R83 R89 L91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5hlh, PDBe:5hlh, PDBj:5hlh
PDBsum5hlh
PubMed28086264
UniProtQ5HKZ1

[Back to BioLiP]