Structure of PDB 5h9e Chain C Binding Site BS01

Receptor Information

>5h9e Chain C (length=150) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DEIDAMALYRAWQQLDNGSCAQIRRVSEPDELRDIPAFYRLVQPFGWENP
RHQQALLRMVFCLSAGKNVIRHQDKKTGISLGRALANSGRINERRIFQLI
RADRTADMVQLRRLLTHAEPVLDWPLMARMLTWWGKRERQQLLEDFVLTT

Ligand information

>5h9e Chain M (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gctcgatgttttatttatt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5h9e Structural basis for promiscuous PAM recognition in type I-E Cascade from E. coli.
Resolution	3.21 Å
Binding residue (original residue number in PDB)	E144 Q147 D151 L154
Binding residue (residue number reindexed from 1)	E138 Q141 D145 L148

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0005515	protein binding

	Biological Process
GO:0051607	defense response to virus
GO:0099048	CRISPR-cas system

	Cellular Component
GO:0032991	protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5h9e, PDBe:5h9e, PDBj:5h9e
PDBsum	5h9e
PubMed	26863189
UniProt	P76632\|CSE2_ECOLI CRISPR system Cascade subunit CasB (Gene Name=casB)

[Back to BioLiP]