Structure of PDB 5h10 Chain C Binding Site BS01

Receptor Information
>5h10 Chain C (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEEASFDGTFL
WKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRT
HLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLSSAS
FQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETS
Ligand information
>5h10 Chain F (length=8) Species: 160651 (Peptide display vector fth1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVPIQCTD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5h10 TRAF1-TANk complex
Resolution3.205 Å
Binding residue
(original residue number in PDB)		Y310 D314 F325 A361 F362 R363 D365 S368 F371 A381 S382 G383
Binding residue
(residue number reindexed from 1)		Y90 D94 F105 A141 F142 R143 D145 S148 F151 A161 S162 G163
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5h10, PDBe:5h10, PDBj:5h10
PDBsum5h10
PubMed
UniProtQ13077|TRAF1_HUMAN TNF receptor-associated factor 1 (Gene Name=TRAF1)

[Back to BioLiP]