Structure of PDB 5fgb Chain C Binding Site BS01

Receptor Information
>5fgb Chain C (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVQSGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA
ISGSGGSTYYADSVKGRFTISRDNSKNILYLQMNSLKAEDTATYYCARAV
VFYYSKYFDYWSQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKAEPK
Ligand information
>5fgb Chain F (length=5) Species: 11108 (Hepatitis C virus (isolate H)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NGSWH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fgb Antibody Response to Hypervariable Region 1 Interferes with Broadly Neutralizing Antibodies to Hepatitis C Virus.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		S31 W47 A50 S52 G53 Y59 V101 K107
Binding residue
(residue number reindexed from 1)		S31 W47 A50 S52 G53 Y59 V101 K106
External links