Structure of PDB 5fb0 Chain C Binding Site BS01

Receptor Information
>5fb0 Chain C (length=170) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDPCPENSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIF
CRIKTIQERSSGHQESEVLMRQMQPEEQLKCEFLLLKVYCDSKSSFFASE
PGPQKPMWLNKVKTSLNEQMYTRVEGFVQDMRLIFHNHKEFYREDKFTRL
GIQVQDIFEKNFRNIFAIQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fb0 Multifaceted Histone H3 Methylation and Phosphorylation Readout by the Plant Homeodomain Finger of Human Nuclear Antigen Sp100C
Resolution2.702 Å
Binding residue
(original residue number in PDB)
D696 P697 C698 N701 S702 N703 W711 G712 R713 L714 F715 C716 D718 A735 K737
Binding residue
(residue number reindexed from 1)
D2 P3 C4 N7 S8 N9 W17 G18 R19 L20 F21 C22 D24 A41 K43
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5fb0, PDBe:5fb0, PDBj:5fb0
PDBsum5fb0
PubMed27129259
UniProtP23497|SP100_HUMAN Nuclear autoantigen Sp-100 (Gene Name=SP100)

[Back to BioLiP]