Structure of PDB 5ez0 Chain C Binding Site BS01

Receptor Information
>5ez0 Chain C (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRL
NEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLLVRPN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ez0 Molecular Basis of the Interaction of the Human Protein Tyrosine Phosphatase Non-receptor Type 4 (PTPN4) with the Mitogen-activated Protein Kinase p38 gamma.
Resolution2.35 Å
Binding residue
(original residue number in PDB)
N525 R527
Binding residue
(residue number reindexed from 1)
N15 R17
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:5ez0, PDBe:5ez0, PDBj:5ez0
PDBsum5ez0
PubMed27246854
UniProtP29074|PTN4_HUMAN Tyrosine-protein phosphatase non-receptor type 4 (Gene Name=PTPN4)

[Back to BioLiP]