Structure of PDB 5eyo Chain C Binding Site BS01

Receptor Information
>5eyo Chain C (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATE
YIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eyo MAX is an epigenetic sensor of 5-carboxylcytosine and is altered in multiple myeloma.
Resolution2.39 Å
Binding residue
(original residue number in PDB)
R25 H28 N29 R33 R36 R60
Binding residue
(residue number reindexed from 1)
R6 H9 N10 R14 R17 R41
Binding affinityPDBbind-CN: Kd=31nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:5eyo, PDBe:5eyo, PDBj:5eyo
PDBsum5eyo
PubMed27903915
UniProtP61244|MAX_HUMAN Protein max (Gene Name=MAX)

[Back to BioLiP]