Structure of PDB 5exk Chain C Binding Site BS01

Receptor Information

>5exk Chain C (length=300) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRRLLRLEVRNAQTPIERKPPWIKTRARIGPEYTELKNLVRREGLHTVCE
EAGCPNIFECWEDREATFLIGGDQCTRRCDFCQIDTGKPAELDRDEPRRV
ADSVRTMGLRYATVTGVARDDLPDGGAWLYAATVRAIKELNPSTGVELLI
PDFNGEPTRLAEVFESGPEVLAHNVETVPRIFKRIRPAFTYRRSLGVLTA
ARDAGLVTKSNLILGLGETSDEVRTALGDLRDAGCDIVTITQYLRPSARH
HPVERWVKPEEFVQFARFAEGLGFAGVLAGPLVRSSYRAGRLYEQARNSR

Ligand information

>5exk Chain D (length=8) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ESTKSVSD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5exk Crystallographic snapshots of sulfur insertion by lipoyl synthase.
Resolution	1.86 Å
Binding residue (original residue number in PDB)	K25 I29 Y39 K43 V54 C55 E56 A58 G59 C60 P61 L250 R290 S292
Binding residue (residue number reindexed from 1)	K19 I23 Y33 K37 V48 C49 E50 A52 G53 C54 P55 L244 R284 S286

Enzymatic activity

Enzyme Commision number

2.8.1.8: lipoyl synthase.

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity
GO:0016740	transferase activity
GO:0016992	lipoate synthase activity
GO:0046872	metal ion binding
GO:0051536	iron-sulfur cluster binding
GO:0051539	4 iron, 4 sulfur cluster binding

	Biological Process
GO:0009107	lipoate biosynthetic process
GO:0009249	protein lipoylation

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5exk, PDBe:5exk, PDBj:5exk
PDBsum	5exk
PubMed	27506792
UniProt	P9WK91\|LIPA_MYCTU Lipoyl synthase (Gene Name=lipA)

[Back to BioLiP]