Structure of PDB 5elr Chain C Binding Site BS01

Receptor Information
>5elr Chain C (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAINKNMKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSI
LGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHA
LEEIKKFLIPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5elr Structural basis of RNA recognition and dimerization by the STAR proteins T-STAR and Sam68.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		N71 V73 G74 K75 L77 G78 P79 R80 G81 L84 K85 S96 I97 R104
Binding residue
(residue number reindexed from 1)		N24 V26 G27 K28 L30 G31 P32 R33 G34 L37 K38 S49 I50 R57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5elr, PDBe:5elr, PDBj:5elr
PDBsum5elr
PubMed26758068
UniProtO75525|KHDR3_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 3 (Gene Name=KHDRBS3)

[Back to BioLiP]