Structure of PDB 5e8f Chain C Binding Site BS01

Receptor Information

>5e8f Chain C (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPK
KILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNS
TNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV

Ligand information

>5e8f Chain E (length=5) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KSKTC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5e8f The N- and C-terminal ends of RPGR can bind to PDE6 delta.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	I53 L54 V59 E88 W90 I109 E110 A111 A112 M117 M118 Y149
Binding residue (residue number reindexed from 1)	I52 L53 V58 E87 W89 I108 E109 A110 A111 M116 M117 Y148

Enzymatic activity

Enzyme Commision number

3.1.4.35: 3',5'-cyclic-GMP phosphodiesterase.

Gene Ontology

	Molecular Function
GO:0005095	GTPase inhibitor activity
GO:0005515	protein binding
GO:0031267	small GTPase binding

	Biological Process
GO:0007601	visual perception
GO:0050953	sensory perception of light stimulus

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005929	cilium
GO:0016020	membrane
GO:0030659	cytoplasmic vesicle membrane
GO:0031410	cytoplasmic vesicle
GO:0042995	cell projection

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5e8f, PDBe:5e8f, PDBj:5e8f
PDBsum	5e8f
PubMed	26553937
UniProt	O43924\|PDE6D_HUMAN Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (Gene Name=PDE6D)

[Back to BioLiP]