Structure of PDB 5e6o Chain C Binding Site BS01

Receptor Information
>5e6o Chain C (length=114) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSFKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLV
PEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERD
PDGFVYMVYTSQPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5e6o Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K18 E95
Binding residue
(residue number reindexed from 1)		K4 E81
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5e6o, PDBe:5e6o, PDBj:5e6o
PDBsum5e6o
PubMed26687600
UniProtQ23536|LGG2_CAEEL Protein lgg-2 (Gene Name=lgg-2)

[Back to BioLiP]