Structure of PDB 5dv7 Chain C Binding Site BS01

Receptor Information
>5dv7 Chain C (length=137) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNALMRLNQLKPGLQYKLISQTGPVHAPIFTMSVEVDGSNFEASGPSKKT
AKLHVAVKVLQDMGLPILTKHGKNPVMELNEKRRGLKYELISETGGSHDK
RFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dv7 Nuclear factor 90 uses an ADAR2-like binding mode to recognize specific bases in dsRNA.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		Q411 S550 F555 K573
Binding residue
(residue number reindexed from 1)		Q9 S97 F102 K120
Binding affinityPDBbind-CN: Kd=2.4uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003725 double-stranded RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5dv7, PDBe:5dv7, PDBj:5dv7
PDBsum5dv7
PubMed26712564
UniProtQ9Z1X4|ILF3_MOUSE Interleukin enhancer-binding factor 3 (Gene Name=Ilf3)

[Back to BioLiP]