Structure of PDB 5ds5 Chain C Binding Site BS01

Receptor Information
>5ds5 Chain C (length=252) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMIFLQYGQIDVIDGAFVLIDKTGIRTHIPVGSVACIMLEPGTRVSHAAV
RLAAQVGTLLVWVGEAGVRVYASGQPGGARSDKLLYQAKLALDEDLRLKV
VRKMFELRFGEPAPARRSVEQLRGIEGSRVRATYALLAKQYGVTWNGRDT
INQCISAATSCLYGVTEAAILAAGYAPAIGFVHTGKPLSFVYDIADIIKF
DTVVPKAFEIARRNPGEPDREVRLACRDIFRSSKTLAKLIPLIEDVLAAG
EI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ds5 Foreign DNA capture during CRISPR-Cas adaptive immunity.
Resolution2.951 Å
Binding residue
(original residue number in PDB)		Y22 G23 D36 K37 G57 R59
Binding residue
(residue number reindexed from 1)		Y7 G8 D21 K22 G42 R44
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
GO:0005515 protein binding
GO:0008821 crossover junction DNA endonuclease activity
GO:0017108 5'-flap endonuclease activity
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006974 DNA damage response
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus
GO:0099048 CRISPR-cas system
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ds5, PDBe:5ds5, PDBj:5ds5
PDBsum5ds5
PubMed26503043
UniProtQ46896|CAS1_ECOLI CRISPR-associated endonuclease Cas1 (Gene Name=ygbT)

[Back to BioLiP]