Structure of PDB 5dlj Chain C Binding Site BS01

Receptor Information

>5dlj Chain C (length=280) Species: 83333 (Escherichia coli K-12)

TWLPLNPIPLKDRVSMIFLQYGQIDVIDGAFVLIDKTGIRTHIPVGSVAC
IMLEPGTRVSHAAVRLAAQVGTLLVWVGEAGVRVYASGQPGGARSDKLLY
QAKLALDEDLRLKVVRKMFELRFGEPAPARRSVEQLRGIEGSRVRATYAL
LAKQYGVTWNGRRYDPKDWEKGDTINQCISAATSCLYGVTEAAILAAGYA
PAIGFVHTGKPLSFVYDIADIIKFDTVVPKAFEIARRNPGEPDREVRLAC
RDIFRSSKTLAKLIPLIEDVLAAGEIQPPA

Ligand information

>5dlj Chain H (length=39)

ttttttcgtagctgaggccctcagctacgtttttttttt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5dlj Structural and Mechanistic Basis of PAM-Dependent Spacer Acquisition in CRISPR-Cas Systems.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): D26 V27 I28 D29 G30 S61 A63
• Binding residue (residue number reindexed from 1): D25 V26 I27 D28 G29 S60 A62

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0004520 DNA endonuclease activity
• GO:0005515 protein binding
• GO:0008821 crossover junction DNA endonuclease activity
• GO:0017108 5'-flap endonuclease activity
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0043571 maintenance of CRISPR repeat elements
• GO:0051607 defense response to virus
• GO:0099048 CRISPR-cas system

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5dlj, PDBe:5dlj, PDBj:5dlj
• PDBsum: 5dlj
• PubMed: 26478180
• UniProt: Q46896|CAS1_ECOLI CRISPR-associated endonuclease Cas1 (Gene Name=ygbT)