Structure of PDB 5ddq Chain C Binding Site BS01

Receptor Information
>5ddq Chain C (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRG
QAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Ligand information
>5ddq Chain B (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cguugacccaggaaacugggcggaaguaagguccauugcacuccgggccu
gaagcaacgcg
<<<<<.<<<<<....>>>>>........<<<<<<..........>>>>>>
....>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ddq Structural and Dynamic Basis for Low-Affinity, High-Selectivity Binding of L-Glutamine by the Glutamine Riboswitch.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y12 N14 N15 E18 K21 K22 R46 S47 L48 K49 M50 R51 Q53 F55 Q84 A86 K87 T88 D89 S90 D91
Binding residue
(residue number reindexed from 1)		Y10 N12 N13 E16 K19 K20 R44 S45 L46 K47 M48 R49 Q51 F53 Q82 A84 K85 T86 D87 S88 D89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5ddq, PDBe:5ddq, PDBj:5ddq
PDBsum5ddq
PubMed26655897
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]