Structure of PDB 5dcv Chain C Binding Site BS01

Receptor Information
>5dcv Chain C (length=118) Species: 70601 (Pyrococcus horikoshii OT3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAE
DVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPG
KARDLVEEIAMKVRELMK
Ligand information
>5dcv Chain B (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguaugguggaagcggugaagggaaaccgaguuaacccgccuaagcc
<<<..<<<<<.<<.......<<....>>...>>...>>>>>...>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dcv Structural basis for recognition of a kink-turn motif by an archaeal homologue of human RNase P protein Rpp38
Resolution3.401 Å
Binding residue
(original residue number in PDB)		R46 Q48
Binding residue
(residue number reindexed from 1)		R40 Q42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5dcv, PDBe:5dcv, PDBj:5dcv
PDBsum5dcv
PubMed27114305
UniProtP62009|RL7A_PYRHO Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]