Structure of PDB 5d2n Chain C Binding Site BS01

Receptor Information

>5d2n Chain C (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHG
LTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAVYYCILDNNNDMRFGA
GTRLTVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDV
YITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS

Ligand information

>5d2n Chain G (length=9) Species: 10358 (Cytomegalovirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NLVPMVATV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5d2n Structural Basis for Clonal Diversity of the Public T Cell Response to a Dominant Human Cytomegalovirus Epitope.
Resolution	2.099 Å
Binding residue (original residue number in PDB)	N92 N93 N94
Binding residue (residue number reindexed from 1)	N92 N93 N94

External links

PDB	RCSB:5d2n, PDBe:5d2n, PDBj:5d2n
PDBsum	5d2n
PubMed	26429912

[Back to BioLiP]