Structure of PDB 5c6v Chain C Binding Site BS01

Receptor Information
>5c6v Chain C (length=198) Species: 4530 (Oryza sativa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEEKVHAGEW
DEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDRHDRAKAVDILVKD
LKVFSTFNEELYKEITQLLTLENFRENEQLSKYGDTKSARSIMLIELKKL
IEANPLFREKLVFPTLKASRLRTLINQSLNWQHQLCKNPIKTLFTDHT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5c6v Structural basis for recognition of diverse transcriptional repressors by the TOPLESS family of corepressors.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Y68 K71 F74 K78 N127 Q129
Binding residue
(residue number reindexed from 1)		Y68 K71 F74 K78 N127 Q129
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5c6v, PDBe:5c6v, PDBj:5c6v
PDBsum5c6v
PubMed26601214
UniProtQ5NBT9|TPR1_ORYSJ Protein TPR1 (Gene Name=TPR1)

[Back to BioLiP]