Structure of PDB 5byg Chain C Binding Site BS01

Receptor Information
>5byg Chain C (length=193) Species: 648242 (Adeno-associated virus 2 Srivastava/1982) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPGFYEIVIKVPSGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAE
KLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGR
FLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDESYIPNFL
LPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5byg Structural Insights into the Assembly of the Adeno-associated Virus Type 2 Rep68 Protein on the Integration Site AAVS1.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
K101 M103 V104 R107 F108 Q111 R138 A141
Binding residue
(residue number reindexed from 1)
K94 M96 V97 R100 F101 Q104 R131 A134
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5byg, PDBe:5byg, PDBj:5byg
PDBsum5byg
PubMed26370092
UniProtQ89268|REP78_AAV2S Protein Rep78 (Gene Name=Rep78)

[Back to BioLiP]