Structure of PDB 5b5v Chain C Binding Site BS01

Receptor Information

>5b5v Chain C (length=187) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQIN
MLYGTITDFCTEESCPVMSAGPKYEYHWADGPIKCSAPKYIDYLMTWVQD
QLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQ
EEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL

Ligand information

>5b5v Chain F (length=8) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FLFGSRSS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5b5v Structural basis for autoinhibition and its relief of MOB1 in the Hippo pathway
Resolution	2.193 Å
Binding residue (original residue number in PDB)	K92 Y93 E94 Y95 H96 W97 A98 Y117 W121 R154 R199 E200 P203
Binding residue (residue number reindexed from 1)	K73 Y74 E75 Y76 H77 W78 A79 Y93 W97 R130 R175 E176 P179

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0019209	kinase activator activity
GO:0019900	kinase binding
GO:0046872	metal ion binding

	Biological Process
GO:0031952	regulation of protein autophosphorylation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5b5v, PDBe:5b5v, PDBj:5b5v
PDBsum	5b5v
PubMed	27335147
UniProt	Q8BPB0\|MOB1B_MOUSE MOB kinase activator 1B (Gene Name=Mob1b)

[Back to BioLiP]