Structure of PDB 5avi Chain C Binding Site BS01

Receptor Information
>5avi Chain C (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQLSPEQLGMIEKLVAAQQRVTPWPSREARQQRFAHFTELAIVSVQEIVD
FAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFS
YNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRP
NVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5avi Discovery and structure-guided optimization of tert-butyl 6-(phenoxymethyl)-3-(trifluoromethyl)benzoates as liver X receptor agonists
Resolution2.7 Å
Binding residue
(original residue number in PDB)		V269 K273 R283 E284 I287 A288 K291 P437 L438 E441
Binding residue
(residue number reindexed from 1)		V49 K53 R63 E64 I67 A68 K71 P217 L218 E221
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006629 lipid metabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5avi, PDBe:5avi, PDBj:5avi
PDBsum5avi
PubMed26238323
UniProtQ13133|NR1H3_HUMAN Oxysterols receptor LXR-alpha (Gene Name=NR1H3)

[Back to BioLiP]