Structure of PDB 5a53 Chain C Binding Site BS01

Receptor Information
>5a53 Chain C (length=225) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVENVKQALFIPGQSCNKNLHDIMVDLSALKKPDMKRFNRKNDIHPFEDM
SPLEFFSEKNDCSLMVLMTSSKKRKNNMTFIRTFGYKIYDMIELMVADNF
KLLSDFKKLTFTVGLKPMFTFQGAAFDTHPVYKQIKSLFLDFFRGESTDL
QDVAGLQHVISMTIQGDFQDGEPLPNVLFRVYKLKSYKSRLPRIELVEIG
PRLDFKIGRIHTPSPDMVTEAHKKP
Ligand information
>5a53 Chain B (length=22) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVMTLLQLPDPTTDLPREKPLP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a53 Chaperoning 5S RNA Assembly.
Resolution2.401 Å
Binding residue
(original residue number in PDB)		E25 K28 D83 S85 R104 F106 Y111 S159 R166 D171 L172 Q173 D174 V175 A248 H249 K251
Binding residue
(residue number reindexed from 1)		E3 K6 D61 S63 R82 F84 Y89 S137 R144 D149 L150 Q151 D152 V153 A221 H222 K224
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000470 maturation of LSU-rRNA
GO:0006364 rRNA processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5a53, PDBe:5a53, PDBj:5a53
PDBsum5a53
PubMed26159998
UniProtP36160|RPF2_YEAST Ribosome biogenesis protein RPF2 (Gene Name=RPF2)

[Back to BioLiP]