Structure of PDB 4zvu Chain C Binding Site BS01

Receptor Information
>4zvu Chain C (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGF
DVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGV
TPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zvu Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
Resolution2.601 Å
Binding residue
(original residue number in PDB)		R387 H444 Q484 C486
Binding residue
(residue number reindexed from 1)		R31 H88 Q128 C130
Enzymatic activity
Catalytic site (original residue number in PDB) G385 V386 H444 G445 C486
Catalytic site (residue number reindexed from 1) G29 V30 H88 G89 C130
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4zvu, PDBe:4zvu, PDBj:4zvu
PDBsum4zvu
PubMed27032039
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]