Structure of PDB 4zm0 Chain C Binding Site BS01

Receptor Information
>4zm0 Chain C (length=55) Species: 10678 (Punavirus P1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKA
ALDAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zm0 An intrinsically disordered entropic switch determines allostery in Phd-Doc regulation.
Resolution3.17 Å
Binding residue
(original residue number in PDB)		S14 R31
Binding residue
(residue number reindexed from 1)		S14 R31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
GO:0097351 toxin sequestering activity
Biological Process
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4zm0, PDBe:4zm0, PDBj:4zm0
PDBsum4zm0
PubMed27159580
UniProtQ06253|PHD_BPP1 Antitoxin phd (Gene Name=phd)

[Back to BioLiP]