Structure of PDB 4yo0 Chain C Binding Site BS01

Receptor Information
>4yo0 Chain C (length=198) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGRSLKLSCAASGFTFSNYGMAWVRQTPTKGLEWIAS
ISAGGDKTYYGDSVKGRFSISRDNAKTTHYLQMDSLRSEDTATYYCAKTS
RVYFDYWGQGVMVTVSSAETTAPSVYPLAPMVTLGCLVKGYFPEPVTVTW
NSGALSSGVHTFPAVLQSGLYTLTSSVTVTCNVAHPASSTKVDKKIVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yo0 Tailored placement of a turn-forming PA tag into the structured domain of a protein to probe its conformational state
Resolution1.56 Å
Binding residue
(original residue number in PDB)		N50 Y51 G52 K76 Y78 T118 S119 R120 V121 F123
Binding residue
(residue number reindexed from 1)		N31 Y32 G33 K57 Y59 T99 S100 R101 V102 F104
External links