Structure of PDB 4yg7 Chain C Binding Site BS01

Receptor Information
>4yg7 Chain C (length=71) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTT
LTTFFKILQSLELSMTLCDAK
Ligand information
>4yg7 Chain R (length=50) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcttatccccttaaggggatatatatatatatatccccttaaggggataa
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yg7 HipBA-promoter structures reveal the basis of heritable multidrug tolerance.
Resolution3.77 Å
Binding residue
(original residue number in PDB)		R21 T27 S29 Q39 A40 S43 N47
Binding residue
(residue number reindexed from 1)		R18 T24 S26 Q36 A37 S40 N44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4yg7, PDBe:4yg7, PDBj:4yg7
PDBsum4yg7
PubMed26222023
UniProtP23873|HIPB_ECOLI Antitoxin HipB (Gene Name=hipB)

[Back to BioLiP]