Structure of PDB 4y60 Chain C Binding Site BS01

Receptor Information
>4y60 Chain C (length=76) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEK
RPFVEEAERLRVQHLRDHPNYKYRPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4y60 Structure and decoy-mediated inhibition of the SOX18/Prox1-DNA interaction.
Resolution1.75 Å
Binding residue
(original residue number in PDB)
R5 N8 F10 A31 S34 K35 W41 K42 Y72 R73
Binding residue
(residue number reindexed from 1)
R6 N9 F11 A32 S35 K36 W42 K43 Y73 R74
Binding affinityPDBbind-CN: Kd=6.1nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4y60, PDBe:4y60, PDBj:4y60
PDBsum4y60
PubMed26939885
UniProtP43680|SOX18_MOUSE Transcription factor SOX-18 (Gene Name=Sox18)

[Back to BioLiP]