Structure of PDB 4y00 Chain C Binding Site BS01

Receptor Information
>4y00 Chain C (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF
TEYETQVKVMSQRHMIGGRWCDCKLPN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4y00 Structural analysis of disease-related TDP-43 D169G mutation: linking enhanced stability and caspase cleavage efficiency to protein accumulation
Resolution3.0 Å
Binding residue
(original residue number in PDB)		I107 L109 G110 L111 K145 G146 F147 F149 R171 K176 P178 N179
Binding residue
(residue number reindexed from 1)		I5 L7 G8 L9 K43 G44 F45 F47 R69 K74 P76 N77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4y00, PDBe:4y00, PDBj:4y00
PDBsum4y00
PubMed26883171
UniProtQ13148|TADBP_HUMAN TAR DNA-binding protein 43 (Gene Name=TARDBP)

[Back to BioLiP]